PlantTFDB
Plant Transcription Factor Database
v4.0
Previous version: v3.0
Transcription Factor Information
Basic Information | Signature Domain | Sequence | 
Basic Information? help Back to Top
TF ID XP_013602256.1
Organism
Taxonomic ID
Taxonomic Lineage
cellular organisms; Eukaryota; Viridiplantae; Streptophyta; Streptophytina; Embryophyta; Tracheophyta; Euphyllophyta; Spermatophyta; Magnoliophyta; Mesangiospermae; eudicotyledons; Gunneridae; Pentapetalae; rosids; malvids; Brassicales; Brassicaceae; Brassiceae; Brassica
Family bZIP
Protein Properties Length: 328aa    MW: 36175 Da    PI: 5.8347
Description bZIP family protein
Gene Model
Gene Model ID Type Source Coding Sequence
XP_013602256.1genomeNCBIView CDS
Signature Domain? help Back to Top
Signature Domain
No. Domain Score E-value Start End HMM Start HMM End
1bZIP_130.86.3e-10136185554
                     CHHHCHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHHH CS
          bZIP_1   5 krerrkqkNReAArrsRqRKkaeieeLeekvkeLeaeNkaLkkeleelkk 54 
                     kr++r   NR +A rs +RK  +i+eLe+kv++L++e ++L  +l   + 
  XP_013602256.1 136 KRAKRILANRQSAARSKERKARYIQELERKVQSLQTEATTLSAQLTLFQR 185
                     9****************************************998876665 PP

Protein Features ? help Back to Top
3D Structure
Database Entry ID E-value Start End InterPro ID Description
SMARTSM003383.1E-16132196IPR004827Basic-leucine zipper domain
PROSITE profilePS5021710.909134197IPR004827Basic-leucine zipper domain
PfamPF001703.7E-8136184IPR004827Basic-leucine zipper domain
SuperFamilySSF579591.83E-10136187No hitNo description
Gene3DG3DSA:1.20.5.1706.6E-10136191No hitNo description
CDDcd147032.14E-21137186No hitNo description
Gene Ontology ? help Back to Top
GO Term GO Category GO Description
GO:0006355Biological Processregulation of transcription, DNA-templated
GO:0005829Cellular Componentcytosol
GO:0003700Molecular Functiontranscription factor activity, sequence-specific DNA binding
GO:0043565Molecular Functionsequence-specific DNA binding
Sequence ? help Back to Top
Protein Sequence    Length: 328 aa     Download sequence    Send to blast
MEKSDPQPPN ADQIPSSFHR RSRSDDMSMF MFMDPLSSSG PPPSSDDLPS DDDLFSSFID  60
VDSLSSNPHP TTTAFPNHAA AAAAASNSVP SSSSRPRHRH SNSVDAGCAM YANEIMDAKK  120
AMPPEKLSEL WNVDPKRAKR ILANRQSAAR SKERKARYIQ ELERKVQSLQ TEATTLSAQL  180
TLFQRDTNGL ANENTELKLR LQAMEQQAHL RNALNEALRK ELERMKIETG EISGNSDSFD  240
MGMQQVQYSP STFMAIPPYH HGSINNGQDM QQMHGYNPME AMSNSQSVSE FLQNGRLQGL  300
EISSNNNSSS LVKSEGPSLS ASESSSAY
Binding Motif ? help Back to Top
Motif ID Method Source Motif file
MP00129DAPTransfer from AT1G06850Download
Motif logo
Regulation -- PlantRegMap ? help Back to Top
Source Upstream Regulator Target Gene
PlantRegMapRetrieveRetrieve
Annotation -- Protein ? help Back to Top
Source Hit ID E-value Description
RefseqXP_013602256.10.0PREDICTED: transcription factor RF2b-like
SwissprotQ6S4P46e-83RF2B_ORYSJ; Transcription factor RF2b
TrEMBLA0A078FA860.0A0A078FA86_BRANA; BnaC08g44990D protein
TrEMBLA0A0D3DYP40.0A0A0D3DYP4_BRAOL; Uncharacterized protein
STRINGBra031541.1-P0.0(Brassica rapa)
Orthologous Group ? help Back to Top
LineageOrthologous Group IDTaxa NumberGene Number
MalvidsOGEM135551727
Best hit in Arabidopsis thaliana ? help Back to Top
Hit ID E-value Description
AT1G06850.11e-123basic leucine-zipper 52